Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cicer arietinum ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Cicer arietinum ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B5LMM9

Expression Region

1-81

Origin

Cicer arietinum (Chickpea) (Garbanzo)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPIISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEDKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Iso Valerylglycine
TRC-I917600-2.5G 2.5 g

N-Iso Valerylglycine

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/2877R), CF740 conjugate, 0.1mg/mL
BNC742877-500 1x 500 µL

CD45RB (B-Cell Marker) (PTPRC/2877R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS801385 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR566316 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details
Histone H4 (Ab-16) Antibody
8D0034-AAT 50 µg

Histone H4 (Ab-16) Antibody

Sign In for Pricing
View Details
(R)-Viloxazine Hydrochloride
TRC-V312450-50MG 50 mg

(R)-Viloxazine Hydrochloride

Sign In for Pricing
View Details