Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cicer arietinum ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Cicer arietinum ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B5LMM9

Expression Region

1-81

Origin

Cicer arietinum (Chickpea) (Garbanzo)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPIISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEDKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5alpha-Androstan-3beta,17alpha-diol
TRC-A637335-25MG 25 mg

5alpha-Androstan-3beta,17alpha-diol

Sign In for Pricing
View Details
Human Myosin light chain 3 (MYL3) activation kit by CRISPRa
GA103074 1 Kit

Human Myosin light chain 3 (MYL3) activation kit by CRISPRa

Sign In for Pricing
View Details
Human TMCO4 activation kit by CRISPRa
GA116810 1 Kit

Human TMCO4 activation kit by CRISPRa

Sign In for Pricing
View Details
Ramoplanin
TRC-R113030-250MG 250 mg

Ramoplanin

Sign In for Pricing
View Details
HIF-1 alpha (HIF1A) Goat Polyclonal Antibody
AB0070-100 300 µg

HIF-1 alpha (HIF1A) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Sftpb Mouse Gene Knockout Kit (CRISPR)
KN515665 1 Kit

Sftpb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details