Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cicer arietinum ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Cicer arietinum ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B5LMM9

Expression Region

1-81

Origin

Cicer arietinum (Chickpea) (Garbanzo)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPIISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEDKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosmet-oxon
TRC-P353705-50MG 50 mg

Phosmet-oxon

Sign In for Pricing
View Details
Glycodehydrocholic acid
TRC-G252740-250MG 250 mg

Glycodehydrocholic acid

Sign In for Pricing
View Details
Human COPZ2 activation kit by CRISPRa
GA109659 1 Kit

Human COPZ2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human ZNF613 activation kit by CRISPRa
GA112716 1 Kit

Human ZNF613 activation kit by CRISPRa

Sign In for Pricing
View Details
Ep-CAM / CD326 (HEA125), 1mg/mL
BNUM0825-50 1x 50 µL

Ep-CAM / CD326 (HEA125), 1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF740 conjugate, 0.1mg/mL
BNC741798-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details