Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyanothece sp. ATP synthase subunit c (atpE)

This Recombinant Cyanothece sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7K5I4

Expression Region

1-81

Origin

Cyanothece sp. (strain PCC 8801) (Synechococcus sp. (strain PCC 8801 / RF-1) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPTVAAASVIAAALAVGLAAIGPGFGQGNASGEAVSGIARQPEAEGKIRGTLLLSLAFM ESLTIYGLVIALVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nfasc Rabbit Monoclonal Antibody [Clone ID: R07-0B3]
TA422011 100 µL

Nfasc Rabbit Monoclonal Antibody [Clone ID: R07-0B3]

Sign In for Pricing
View Details
Src (Ab-75) Antibody
8B8186-AAT 50 µg

Src (Ab-75) Antibody

Sign In for Pricing
View Details
Human IL-2 Antibody Pair Set
E-KAB-0044 50 µL & 100 µg

Human IL-2 Antibody Pair Set

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF568 conjugate, 0.1mg/mL
BNC680385-100 1x 100 µL

CD3e (Rabbit PAb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS621524 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
3-Fluorobenzyl Alcohol
TRC-F597998-500MG 500 mg

3-Fluorobenzyl Alcohol

Sign In for Pricing
View Details