Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE)

This Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7I1V9

Expression Region

1-81

Origin

Acinetobacter baumannii (strain AB0057)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLD AVPMIGVGIGLFFIFANPFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyanoacetic Acid
TRC-C987485-50G 50 g

Cyanoacetic Acid

Sign In for Pricing
View Details
4-Iodo-1-tritylimidazole
TRC-I724850-500MG 500 mg

4-Iodo-1-tritylimidazole

Sign In for Pricing
View Details
Dematin (DMTN) (NM_001302816) Human Tagged ORF Clone
RG237878 10 µg

Dematin (DMTN) (NM_001302816) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS802901 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Satb2 Mouse Gene Knockout Kit (CRISPR)
KN315311BN 1 Kit

Satb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CEBP Beta (CEBPB) (C-term) Rabbit Polyclonal Antibody
AP17939PU-N 400 µL

CEBP Beta (CEBPB) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details