Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE)

This Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7I1V9

Expression Region

1-81

Origin

Acinetobacter baumannii (strain AB0057)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLD AVPMIGVGIGLFFIFANPFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF647 conjugate, 0.1mg/mL
BNC472052-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin Mouse Monoclonal Antibody [Clone ID: AT13D2]
AM50621PU-N 100 µL

Fascin Mouse Monoclonal Antibody [Clone ID: AT13D2]

Sign In for Pricing
View Details
Gly-Pro-CN Hydrochloride Salt
TRC-G523560-250MG 250 mg

Gly-Pro-CN Hydrochloride Salt

Sign In for Pricing
View Details
NMU Antibody
8C16975-AAT 50 µg

NMU Antibody

Sign In for Pricing
View Details
Human LYSMD2 activation kit by CRISPRa
GA116867 1 Kit

Human LYSMD2 activation kit by CRISPRa

Sign In for Pricing
View Details
PIG3 (TP53I3) (1-332) Mouse Monoclonal Antibody [Clone ID: AT1C9]
AM50012PU-S 50 µL

PIG3 (TP53I3) (1-332) Mouse Monoclonal Antibody [Clone ID: AT1C9]

Sign In for Pricing
View Details