Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE)

This Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7I1V9

Expression Region

1-81

Origin

Acinetobacter baumannii (strain AB0057)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLD AVPMIGVGIGLFFIFANPFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A6]
TA502924BM 100 µL

p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A6]

Sign In for Pricing
View Details
FZD3 Rabbit Polyclonal Antibody
AP01315PU-N 100 µg

FZD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
10-GO RE Kit Set D
RK4000 1 Kit

10-GO RE Kit Set D

Sign In for Pricing
View Details
Mannose BSA Colloidal Gold Conjugate, 1mL 40nm
CCG-0001-40 1 mL

Mannose BSA Colloidal Gold Conjugate, 1mL 40nm

Sign In for Pricing
View Details
Alpha-Bungarotoxin, CF®568 100ug
#00006-100ug 1x 100 µg

Alpha-Bungarotoxin, CF®568 100ug

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS500521 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details