Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyanothece sp. ATP synthase subunit c (atpE)

This Recombinant Cyanothece sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7KKR8

Expression Region

1-81

Origin

Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPMLASASVIAAALAVGLAAIGPGIGQGNASGQAVSGIARQPEAEGKIRGTLLLTLAFM ESLTIYGLVISLVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-inaD (Thr666) Rabbit Polyclonal Antibody (BF680)
orb2498135 100 µL

Phospho-inaD (Thr666) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Rabbit Monoclonal PD-1 Antibody (PDCD1/4231R) [Alexa Fluor 350]
NBP3-20955AF350 0.1 mL

Rabbit Monoclonal PD-1 Antibody (PDCD1/4231R) [Alexa Fluor 350]

Sign In for Pricing
View Details
ELOC Human siRNA Oligo Duplex (Locus ID 6921)
SR304736 1 Kit

ELOC Human siRNA Oligo Duplex (Locus ID 6921)

Sign In for Pricing
View Details
Enpp-1-IN-20
T209278-01 10 mg

Enpp-1-IN-20

Sign In for Pricing
View Details
Enpp-1-IN-20
T209278-02 50 mg

Enpp-1-IN-20

Sign In for Pricing
View Details
1- (2-Fluorophenyl) -2- (4-fluorophenyl) ethanone
JXB75466-01 100 mg

1- (2-Fluorophenyl) -2- (4-fluorophenyl) ethanone

Sign In for Pricing
View Details