Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyanothece sp. ATP synthase subunit c (atpE)

This Recombinant Cyanothece sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7KKR8

Expression Region

1-81

Origin

Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPMLASASVIAAALAVGLAAIGPGIGQGNASGQAVSGIARQPEAEGKIRGTLLLTLAFM ESLTIYGLVISLVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Cytosolic Fe-S cluster assembly factor NARFL (NARFL)
MBS1471189-01 0.02 mg (E-Coli)

Recombinant Human Cytosolic Fe-S cluster assembly factor NARFL (NARFL)

Sign In for Pricing
View Details
Recombinant Human Cytosolic Fe-S cluster assembly factor NARFL (NARFL)
MBS1471189-02 0.02 mg (Yeast)

Recombinant Human Cytosolic Fe-S cluster assembly factor NARFL (NARFL)

Sign In for Pricing
View Details
Recombinant Human Cytosolic Fe-S cluster assembly factor NARFL (NARFL)
MBS1471189-03 0.1 mg (E-Coli)

Recombinant Human Cytosolic Fe-S cluster assembly factor NARFL (NARFL)

Sign In for Pricing
View Details
Recombinant Human Cytosolic Fe-S cluster assembly factor NARFL (NARFL)
MBS1471189-04 0.1 mg (Yeast)

Recombinant Human Cytosolic Fe-S cluster assembly factor NARFL (NARFL)

Sign In for Pricing
View Details
Recombinant Human Cytosolic Fe-S cluster assembly factor NARFL (NARFL)
MBS1471189-05 0.02 mg (Baculovirus)

Recombinant Human Cytosolic Fe-S cluster assembly factor NARFL (NARFL)

Sign In for Pricing
View Details
Recombinant Human Cytosolic Fe-S cluster assembly factor NARFL (NARFL)
MBS1471189-06 0.02 mg (Mammalian-Cell)

Recombinant Human Cytosolic Fe-S cluster assembly factor NARFL (NARFL)

Sign In for Pricing
View Details