Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium bovis ATP synthase subunit c (atpE)

This Recombinant Mycobacterium bovis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C1AMU9

Expression Region

1-81

Origin

Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Fruit fly l(2)efl/CryAB Antibody, HRP Conjugate
DZ33926-HRP 200 µL/Vial

Anti-Fruit fly l(2)efl/CryAB Antibody, HRP Conjugate

Sign In for Pricing
View Details
Olfactory receptor 8I2 Polyclonal Antibody
JOT-AP06552-01 20 µL

Olfactory receptor 8I2 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 8I2 Polyclonal Antibody
JOT-AP06552-02 50 μL

Olfactory receptor 8I2 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 8I2 Polyclonal Antibody
JOT-AP06552-03 100 µL

Olfactory receptor 8I2 Polyclonal Antibody

Sign In for Pricing
View Details
pUNO1-hCD3G
puno1-hcd3g 20 µg

pUNO1-hCD3G

Sign In for Pricing
View Details
Recombinant Mouse Ribonuclease-like protein 12 (Rnase12)
MBS1372766-01 0.02 mg (E-Coli)

Recombinant Mouse Ribonuclease-like protein 12 (Rnase12)

Sign In for Pricing
View Details