Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium bovis ATP synthase subunit c (atpE)

This Recombinant Mycobacterium bovis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

C1AMU9

Expression Region

1-81

Origin

Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD62p Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-56209R-APC-Cy5.5 100 µL

CD62p Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
DIS3L Double Nickase Plasmid (m)
sc-431884-NIC 20 µg

DIS3L Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Ankrd53 sgRNA CRISPR Lentivector set (Mouse)
K3826001 3x 1.0 µg

Ankrd53 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
CCND3 ELISA Kit (Human)
OKEH03156-96W 96 Well

CCND3 ELISA Kit (Human)

Sign In for Pricing
View Details
PPP2R2A Human shRNA Plasmid Kit (Locus ID 5520)
TL310225 1 Kit

PPP2R2A Human shRNA Plasmid Kit (Locus ID 5520)

Sign In for Pricing
View Details
SNX18P9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV749185 1.0 µg DNA

SNX18P9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details