Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE)

This Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B0VBP8

Expression Region

1-81

Origin

Acinetobacter baumannii (strain AYE)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLD AVPMIGVGIGLFFIFANPFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC2 ELISA Kit (Mouse) (OKWB00269)
OKWB00269 96 Well

TSC2 ELISA Kit (Mouse) (OKWB00269)

Sign In for Pricing
View Details
Rabbit Protein Wnt-7a ELISA Kit
GTR10412974 96 Well

Rabbit Protein Wnt-7a ELISA Kit

Sign In for Pricing
View Details
PSEN1 Rabbit Polyclonal Antibody
AF7830 50 µL

PSEN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Collagen Type I ELISA Kit (COL1)
RK03578 96 Tests

Rat Collagen Type I ELISA Kit (COL1)

Sign In for Pricing
View Details
2-(2,2-Difluorobenzo[d][1,3]dioxol-5-yl)acetonitrile
TRC-D452093-50MG 50 mg

2-(2,2-Difluorobenzo[d][1,3]dioxol-5-yl)acetonitrile

Sign In for Pricing
View Details
Recombinant Shigella Flexneri hfq Protein (aa 2-102)
VAng-Lsx07839-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Flexneri hfq Protein (aa 2-102)

Sign In for Pricing
View Details