Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE)

This Recombinant Acinetobacter baumannii ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B0VBP8

Expression Region

1-81

Origin

Acinetobacter baumannii (strain AYE)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLD AVPMIGVGIGLFFIFANPFVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR1E siRNA (Mouse)
MBS8209692-01 15 nmol

POLR1E siRNA (Mouse)

Sign In for Pricing
View Details
POLR1E siRNA (Mouse)
MBS8209692-02 30 nmol

POLR1E siRNA (Mouse)

Sign In for Pricing
View Details
POLR1E siRNA (Mouse)
MBS8209692-03 5x 30 nmol

POLR1E siRNA (Mouse)

Sign In for Pricing
View Details
DCT ELISA Kit (Human) (OKCD07112)
OKCD07112 96 Well

DCT ELISA Kit (Human) (OKCD07112)

Sign In for Pricing
View Details
Rabbit Polyclonal IRAK2 Antibody [Alexa Fluor 647]
NBP1-76641AF647 0.1 mL

Rabbit Polyclonal IRAK2 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Rat VGF Nerve Growth Factor Inducible (VGF) ELISA Kit
RDR-VGF-Ra-48Tests 48 Tests

Rat VGF Nerve Growth Factor Inducible (VGF) ELISA Kit

Sign In for Pricing
View Details