Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Adipogenin (ADIG)

This Recombinant Pig Adipogenin (ADIG) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Adipogenin, Small adipocyte factor 1, SMAF-1

UniProt

Q30C86

Expression Region

1-81

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYPLVPLVNELTFSFLASWLCLPVGLLLFLLIVWLRFLLSQDSEENDSDLCFDWEPWSK GPAEFCQEETLHSPEEERPCW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Was Mouse Gene Knockout Kit (CRISPR)
KN519312 1 Kit

Was Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Baz2b Mouse Gene Knockout Kit (CRISPR)
KN501990 1 Kit

Baz2b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LZIC Human Gene Knockout Kit (CRISPR)
KN209433 1 Kit

LZIC Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RIPK5 (DSTYK) Rabbit Polyclonal Antibody
TA364977 100 µL

RIPK5 (DSTYK) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Apolipoprotein A II (APOA2) Human Gene Knockout Kit (CRISPR)
KN402723 1 Kit

Apolipoprotein A II (APOA2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRITC Conjugated Goat Affinity Purified Antibody to Human IgD
RAF-004-2 2 mL

TRITC Conjugated Goat Affinity Purified Antibody to Human IgD

Sign In for Pricing
View Details