Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Adipogenin (ADIG)

This Recombinant Pig Adipogenin (ADIG) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Adipogenin, Small adipocyte factor 1, SMAF-1

UniProt

Q30C86

Expression Region

1-81

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYPLVPLVNELTFSFLASWLCLPVGLLLFLLIVWLRFLLSQDSEENDSDLCFDWEPWSK GPAEFCQEETLHSPEEERPCW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon: right
CS505841 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Cytokeratin, multi (KRT/457), Biotin conjugate, 0.1mg/mL
BNCB0457-500 1x 500 µL

Cytokeratin, multi (KRT/457), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF594 conjugate, 0.1mg/mL
BNC941986-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HDAC1 Human Gene Knockout Kit (CRISPR)
KN201745LP 1 Kit

HDAC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tafa2 (NM_182807) Mouse Tagged ORF Clone
MG200805 10 µg

Tafa2 (NM_182807) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
HNF1A (Pancreatic Tumor Suppressor) (HNF1A/2087), CF740 conjugate, 0.1mg/mL
BNC742087-100 1x 100 µL

HNF1A (Pancreatic Tumor Suppressor) (HNF1A/2087), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details