Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Morus indica ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Morus indica ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q09X30

Expression Region

1-81

Origin

Morus indica (Mulberry)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DKK2 Rabbit Polyclonal Antibody (BF750)
orb2528821 100 µL

DKK2 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Human BTG3 Associated Nuclear Protein (BANP) ELISA Kit
RD-BANP-Hu-01 96 Tests

Human BTG3 Associated Nuclear Protein (BANP) ELISA Kit

Sign In for Pricing
View Details
Human BTG3 Associated Nuclear Protein (BANP) ELISA Kit
RD-BANP-Hu-02 48 Tests

Human BTG3 Associated Nuclear Protein (BANP) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse IL12B/IL-12 p40/NKSF2 Protein, C-Strep
EMD84001 100 μg

Recombinant Mouse IL12B/IL-12 p40/NKSF2 Protein, C-Strep

Sign In for Pricing
View Details
Lentiviral mouse Atp6v1g2 shRNA (UAS) - Lentiviral mouse Atp6v1g2 shRNA (UAS) (25)
GTR15168629 1 Vial

Lentiviral mouse Atp6v1g2 shRNA (UAS) - Lentiviral mouse Atp6v1g2 shRNA (UAS) (25)

Sign In for Pricing
View Details
2-Bromo-4-iodobenzamide
OR314033-01 100 mg

2-Bromo-4-iodobenzamide

Sign In for Pricing
View Details