Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Morus indica ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Morus indica ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q09X30

Expression Region

1-81

Origin

Morus indica (Mulberry)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Calsenilin, KCNIP3 ELISA KIT
ELI-47495h 96 Tests

Human Calsenilin, KCNIP3 ELISA KIT

Sign In for Pricing
View Details
Research Grade Anti-Human CD20/MS4A1 (MT-3724)
DHC90736 100 μg

Research Grade Anti-Human CD20/MS4A1 (MT-3724)

Sign In for Pricing
View Details
Nfix 3'UTR Lenti-reporter-Luc Vector
31775086 1.0 µg

Nfix 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse Monoclonal IL-17E/IL-25 Antibody (68C1039.2) [mFluor Violet 450 SE]
NB100-56541MFV450 0.1 mL

Mouse Monoclonal IL-17E/IL-25 Antibody (68C1039.2) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Polyco Matrix P Grip PU Palm Coated Gloves Black - Size 9
SAF2792 12 PR

Polyco Matrix P Grip PU Palm Coated Gloves Black - Size 9

Sign In for Pricing
View Details
Recombinant Porphyromonas gingivalis DNA replication and repair protein recF (recF)
MBS1401516-01 0.02 mg (E-Coli)

Recombinant Porphyromonas gingivalis DNA replication and repair protein recF (recF)

Sign In for Pricing
View Details