Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Morus indica ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Morus indica ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q09X30

Expression Region

1-81

Origin

Morus indica (Mulberry)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHRS13 Antibody - C-terminal region : HRP (ARP70144_P050-HRP)
ARP70144_P050-HRP 100 µL

DHRS13 Antibody - C-terminal region : HRP (ARP70144_P050-HRP)

Sign In for Pricing
View Details
IFNL1 Antibody
orb1312764-01 30 µL

IFNL1 Antibody

Sign In for Pricing
View Details
IFNL1 Antibody
orb1312764-02 50 μL

IFNL1 Antibody

Sign In for Pricing
View Details
IFNL1 Antibody
orb1312764-03 100 µL

IFNL1 Antibody

Sign In for Pricing
View Details
VE 821
TRC-V756700-10MG 10 mg

VE 821

Sign In for Pricing
View Details
Genorise® recombinant human Yorkie (Yki) protein
GR119117 5 µg

Genorise® recombinant human Yorkie (Yki) protein

Sign In for Pricing
View Details