Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit c (atpE)

This Recombinant Synechococcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q0I7Q8

Expression Region

1-81

Origin

Synechococcus sp. (strain CC9311)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITSAASVVAAGLAVGLAAIGPGIGQGSASQGAVEGIARQPEAEGKIRGTLLLSLAFM ESLTIYGLVVALVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Protein HOTHEAD (HTH) , partial
MBS1405440 Inquire

Recombinant Arabidopsis thaliana Protein HOTHEAD (HTH) , partial

Sign In for Pricing
View Details
Rabbit Polyclonal LIS1 Antibody [Alexa Fluor 647]
NBP1-76815AF647 0.1 mL

Rabbit Polyclonal LIS1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
LHCGR Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV656752 1.0 µg DNA

LHCGR Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Anti-Phospho-Tie-2 (Y992) antibody
STJ90597 200 µl

Anti-Phospho-Tie-2 (Y992) antibody

Sign In for Pricing
View Details
GRID1
400775-01 50 µL

GRID1

Sign In for Pricing
View Details
GRID1
400775-02 100 µL

GRID1

Sign In for Pricing
View Details