Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trichodesmium erythraeum ATP synthase subunit c (atpE)

This Recombinant Trichodesmium erythraeum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q112Z2

Expression Region

1-81

Origin

Trichodesmium erythraeum (strain IMS101)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLIAAASVVAAALAVGLGAIGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVSLVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WDR93 activation kit by CRISPRa
GA111306 1 Kit

Human WDR93 activation kit by CRISPRa

Sign In for Pricing
View Details
rac trans-3-Hydroxy Apatinib Dihydrochloride
TRC-H802105-1MG 1 mg

rac trans-3-Hydroxy Apatinib Dihydrochloride

Sign In for Pricing
View Details
7-Amino Nimetazepam
TRC-A618300-25MG 25 mg

7-Amino Nimetazepam

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF647 conjugate, 0.1mg/mL
BNC472375-500 1x 500 µL

Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRR20B (NM_001130404) Human Over-expression Lysate
LY427198 100 µg

PRR20B (NM_001130404) Human Over-expression Lysate

Sign In for Pricing
View Details
CXorf48 (CT55) (NM_001031705) Human Over-expression Lysate
LY422158 100 µg

CXorf48 (CT55) (NM_001031705) Human Over-expression Lysate

Sign In for Pricing
View Details