Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium sp. ATP synthase subunit c (atpE)

This Recombinant Mycobacterium sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q1B548

Expression Region

1-81

Origin

Mycobacterium sp. (strain MCS)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGIAGNALIAGIARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRH2 Rabbit Polyclonal Antibody
TA371376 100 µL

HRH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human RNF6 siRNA
abx931805-01 15 nmol

Human RNF6 siRNA

Sign In for Pricing
View Details
Human RNF6 siRNA
abx931805-02 30 nmol

Human RNF6 siRNA

Sign In for Pricing
View Details
EVI5L, CT (EVI5L, EVI5-like protein, Ecotropic viral integration site 5-like protein) (MaxLight 490) discontinued
035259-ML490 100 µL

EVI5L, CT (EVI5L, EVI5-like protein, Ecotropic viral integration site 5-like protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
TMEM18 Lentiviral Activation Particles (m2)
sc-431773-LAC-2 200 µL

TMEM18 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
CEP110 Antibody
E19-9360-1 50 µg - 50 µL

CEP110 Antibody

Sign In for Pricing
View Details