Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium sp. ATP synthase subunit c (atpE)

This Recombinant Mycobacterium sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q1B548

Expression Region

1-81

Origin

Mycobacterium sp. (strain MCS)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGIAGNALIAGIARQPEAQGRLFTPFFITVGLV EAAYFINLAFMALFVFATPVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC epsilon, NT (Protein Kinase C, epsilon Type, nPKC-epsilon, PRKCE, PKCE) (Azide free) (HRP) discontinued
P9103-20A3-HRP 200 µL

PKC epsilon, NT (Protein Kinase C, epsilon Type, nPKC-epsilon, PRKCE, PKCE) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
DCBLD2 Knockout HT29 Polyclonal Cells
ARG15017 1 Million

DCBLD2 Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
EPHA10 Antibody - N-terminal region
OAAB04660-400UL 400 µL

EPHA10 Antibody - N-terminal region

Sign In for Pricing
View Details
5830418K08Rik 3'UTR Lenti-reporter-Luc Vector
10813084 1.0 µg

5830418K08Rik 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Hepatitis A Virus (HAV) (MaxLight 405)
MBS6252876-01 0.1 mL

Hepatitis A Virus (HAV) (MaxLight 405)

Sign In for Pricing
View Details
Hepatitis A Virus (HAV) (MaxLight 405)
MBS6252876-02 5x 0.1 mL

Hepatitis A Virus (HAV) (MaxLight 405)

Sign In for Pricing
View Details