Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q2JS34

Expression Region

1-81

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGNTGERPFVDIITSVRYWVIHALTIPALFLAGWLFVSTGLAYDIFGTPRPNEYFTAER QELPIVSDRFNALEQLEKLTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JM4 CRISPR/Cas9 KO Plasmid (h)
sc-407211 20 µg

JM4 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Anti Human IL-4 Flow Cytometry Monoclonal Clone MP425D2 APC Ready To Use 100 Tests
IRTAHUIL4MP425D2CAPC100 100 Tests

Anti Human IL-4 Flow Cytometry Monoclonal Clone MP425D2 APC Ready To Use 100 Tests

Sign In for Pricing
View Details
Human RRM1 Protein, His & GST Tag
KMPH4521-01 20 µg

Human RRM1 Protein, His & GST Tag

Sign In for Pricing
View Details
Human RRM1 Protein, His & GST Tag
KMPH4521-02 50 µg

Human RRM1 Protein, His & GST Tag

Sign In for Pricing
View Details
Phospho-Bik (T33) Antibody
E45R05100G-4 50 µL

Phospho-Bik (T33) Antibody

Sign In for Pricing
View Details
MLH1 Antibody
C13086-01 50 μL

MLH1 Antibody

Sign In for Pricing
View Details