Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q2JS34

Expression Region

1-81

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGNTGERPFVDIITSVRYWVIHALTIPALFLAGWLFVSTGLAYDIFGTPRPNEYFTAER QELPIVSDRFNALEQLEKLTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIP4K2A Antibody (YA8512, Mouse)
HY-P88828 1 Each

PIP4K2A Antibody (YA8512, Mouse)

Sign In for Pricing
View Details
FUT8 Polyclonal Antibody, RBITC Conjugated
bs-6280R-RBITC 100 µL

FUT8 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Glial Fibrillary Acidic Protein (GFAP) Antibody
abx176593-01 100 µL

Glial Fibrillary Acidic Protein (GFAP) Antibody

Sign In for Pricing
View Details
Glial Fibrillary Acidic Protein (GFAP) Antibody
abx176593-02 200 µL

Glial Fibrillary Acidic Protein (GFAP) Antibody

Sign In for Pricing
View Details
Glial Fibrillary Acidic Protein (GFAP) Antibody
abx176593-03 1 mL

Glial Fibrillary Acidic Protein (GFAP) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Adam1a shRNA (UAS) - Lentiviral mouseAdam1a shRNA (UAS, GFP) (25)
GTR15194216 1 Vial

Lentiviral mouse Adam1a shRNA (UAS) - Lentiviral mouseAdam1a shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details