Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit c (atpE)

This Recombinant Synechococcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q2JSV7

Expression Region

1-81

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLTSAASVLSAALAIGLGSLGPGLGQGNAAAAAMEGLARQPEAEDKIRGNLLVSLAFM EALTIYGLVVALVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTURN Human Gene Knockout Kit (CRISPR)
KN422751 1 Kit

MTURN Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Granzyme B Antibody
KC-9806-01 50 μL

Granzyme B Antibody

Sign In for Pricing
View Details
Granzyme B Antibody
KC-9806-02 100 µL

Granzyme B Antibody

Sign In for Pricing
View Details
Granzyme B Antibody
KC-9806-03 1 mL

Granzyme B Antibody

Sign In for Pricing
View Details
EIF4B pSer422 Rabbit Polyclonal Antibody
AP09472PU-S 50 µL

EIF4B pSer422 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dnajc19 (BC024335) Mouse Tagged ORF Clone
MG200742 10 µg

Dnajc19 (BC024335) Mouse Tagged ORF Clone

Sign In for Pricing
View Details