Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit c (atpE)

This Recombinant Synechococcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q2JSV7

Expression Region

1-81

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLTSAASVLSAALAIGLGSLGPGLGQGNAAAAAMEGLARQPEAEDKIRGNLLVSLAFM EALTIYGLVVALVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNNB1 (Catenin beta-1, Beta-catenin, CTNNB, OK/SW-cl.35, PRO2286) (FITC)
029106 100 µg

CTNNB1 (Catenin beta-1, Beta-catenin, CTNNB, OK/SW-cl.35, PRO2286) (FITC)

Sign In for Pricing
View Details
TRIM21 Antibody
orb521649-01 50 μL

TRIM21 Antibody

Sign In for Pricing
View Details
TRIM21 Antibody
orb521649-02 100 µL

TRIM21 Antibody

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)
MBS2050046-01 0.1 mL

HRP-Linked Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)
MBS2050046-02 0.2 mL

HRP-Linked Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)
MBS2050046-03 0.5 mL

HRP-Linked Polyclonal Antibody to Sialic Acid Binding Ig Like Lectin 5 (SIGLEC5)

Sign In for Pricing
View Details