Recombinant Synechococcus sp. ATP synthase subunit c (atpE)
This Recombinant Synechococcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
Q2JIF6
Expression Region
1-81
Origin
Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDPLTSAASVLSAALAIGLGSLGPGLGQGNAAAAAMEGLARQPEAEDKIRGNLLVSLAFM EALTIYGLVVALVLLFANPFA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
128368-ML550 100 µL
IKBKG (NF-kappa-B Essential Modulator, NEMO, NF-kappa-B Essential Modifier, Inhibitor Of Nuclear Factor kappa-B Kinase gamma Subunit, IkB Kinase gamma Subunit, I-kappa-B Kinase gamma, IKK-gamma, IKKG, IkB Kinase-associated Protein 1, IKKAP1, FIP-3, IKK gamma, FIP3, AMCBX1) (MaxLight 550)
Sign In for Pricing
View Details 
CST 44070S 25 µL
TCF1/TCF7 (C63D9) Rabbit Monoclonal Antibody (InTraSeq™ 3' Conjugate 3013)
Sign In for Pricing
View Details NBP2-47889JF549 0.1 mL
Mouse Monoclonal MUC-1 Antibody (SPM492) [Janelia Fluor 549]
Sign In for Pricing
View Details 