Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q2JLF0

Expression Region

1-81

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGSTGERPFVDIITSVRYWVIHALTIPALFLAGWLFVSTGLAYDIFGTPRPNEYFTAER QELPIVSDRFNALEELERLTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF594 conjugate, 0.1mg/mL
BNC942038-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSMA Recombinant Rabbit Monoclonal Antibody [JE42-45]
HA721593 100 µL

PSMA Recombinant Rabbit Monoclonal Antibody [JE42-45]

Sign In for Pricing
View Details
Shiga toxin subunit B Rabbit Polyclonal Antibody
R1305-1 100 µL

Shiga toxin subunit B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) (CD47/3019), CF568 conjugate, 0.1mg/mL
BNC683019-100 1x 100 µL

CD47 / IAP (Integrin Associated Protein) (CD47/3019), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LMTK3 (N-term) Rabbit Polyclonal Antibody
AP52509PU-N 400 µL

LMTK3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CEP55 (NM_001127182) Human Over-expression Lysate
LC426692 20 µg

CEP55 (NM_001127182) Human Over-expression Lysate

Sign In for Pricing
View Details