Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q2JLF0

Expression Region

1-81

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGSTGERPFVDIITSVRYWVIHALTIPALFLAGWLFVSTGLAYDIFGTPRPNEYFTAER QELPIVSDRFNALEELERLTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF 4 (ATF4) Rabbit Polyclonal Antibody
TA364425 100 µL

ATF 4 (ATF4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
S-tag Monoclonal Antibody
E-AB-48020-01 25 µL

S-tag Monoclonal Antibody

Sign In for Pricing
View Details
S-tag Monoclonal Antibody
E-AB-48020-02 100 µL

S-tag Monoclonal Antibody

Sign In for Pricing
View Details
Cep131 Mouse Gene Knockout Kit (CRISPR)
KN503148 1 Kit

Cep131 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CF®680R Rabbit Anti-DNP, 2 mg/mL
#20870-250uL 1x 250 µL

CF®680R Rabbit Anti-DNP, 2 mg/mL

Sign In for Pricing
View Details
Cyclin D2 (CCND2/2620), CF640R conjugate, 0.1mg/mL
BNC402620-100 1x 100 µL

Cyclin D2 (CCND2/2620), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details