Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staurastrum punctulatum ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Staurastrum punctulatum ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q32RS6

Expression Region

1-81

Origin

Staurastrum punctulatum (Green alga)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPVISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCMO1 Antibody
GWB-MX080H 50 µg

BCMO1 Antibody

Sign In for Pricing
View Details
Recombinant Ajellomyces dermatitidis Protein GET1 (GET1), partial
MBS7069382 Inquire

Recombinant Ajellomyces dermatitidis Protein GET1 (GET1), partial

Sign In for Pricing
View Details
Mouse NFE2L2 (Nuclear Factor, Erythroid Derived 2 Like Protein 2) ELISA Kit
EK247531 96 Well

Mouse NFE2L2 (Nuclear Factor, Erythroid Derived 2 Like Protein 2) ELISA Kit

Sign In for Pricing
View Details
7-Methyl-5-phenyl-2,3-dihydro-1H-pyrazolo[1,2-a]indazol-4-ium bromide
DDA29979-01 1 mg

7-Methyl-5-phenyl-2,3-dihydro-1H-pyrazolo[1,2-a]indazol-4-ium bromide

Sign In for Pricing
View Details
7-Methyl-5-phenyl-2,3-dihydro-1H-pyrazolo[1,2-a]indazol-4-ium bromide
DDA29979-02 5 mg

7-Methyl-5-phenyl-2,3-dihydro-1H-pyrazolo[1,2-a]indazol-4-ium bromide

Sign In for Pricing
View Details
7-Methyl-5-phenyl-2,3-dihydro-1H-pyrazolo[1,2-a]indazol-4-ium bromide
DDA29979-03 10 mg

7-Methyl-5-phenyl-2,3-dihydro-1H-pyrazolo[1,2-a]indazol-4-ium bromide

Sign In for Pricing
View Details