Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staurastrum punctulatum ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Staurastrum punctulatum ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q32RS6

Expression Region

1-81

Origin

Staurastrum punctulatum (Green alga)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPVISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIAH3 CRISPR Activation Plasmid (h2)
sc-415321-ACT-2 20 µg

SIAH3 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
PACAP 38 (Frog)
052-01 100 µg

PACAP 38 (Frog)

Sign In for Pricing
View Details
LOC687565 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6016506 1.0 µg DNA

LOC687565 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal ASH2L Antibody - (Dry Ice)
NBP3-18639-25ul 25 µL

Rabbit Polyclonal ASH2L Antibody - (Dry Ice)

Sign In for Pricing
View Details
Anti-SEC23B Antibody Picoband®, iFluor647 Conjugate
A05847-3-iFluor647 100 µg

Anti-SEC23B Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Gm8720 3'UTR Lenti-reporter-Luc Vector
22233084 1.0 µg

Gm8720 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details