Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staurastrum punctulatum ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Staurastrum punctulatum ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q32RS6

Expression Region

1-81

Origin

Staurastrum punctulatum (Green alga)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPVISAASVIAAGLAVGLASIGPGIGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS12 (G-4) Alexa Fluor® 594
sc-398545 AF594 200 µg/mL

RGS12 (G-4) Alexa Fluor® 594

Sign In for Pricing
View Details
HBB Polyclonal Antibody, HRP Conjugated
A50282-050 50 µL

HBB Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
PLCZ1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2411786 100 µL

PLCZ1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
SCN4A (NM_000334) Human Over-expression Lysate
LY424791 100 µg

SCN4A (NM_000334) Human Over-expression Lysate

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor Superfamily Member 11A (TNFRSF11A) Antibody
abx376840-01 50 µg

Tumor Necrosis Factor Receptor Superfamily Member 11A (TNFRSF11A) Antibody

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor Superfamily Member 11A (TNFRSF11A) Antibody
abx376840-02 100 µg

Tumor Necrosis Factor Receptor Superfamily Member 11A (TNFRSF11A) Antibody

Sign In for Pricing
View Details