Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit c (atpE)

This Recombinant Synechococcus sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3AZM5

Expression Region

1-81

Origin

Synechococcus sp. (strain CC9902)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSITSAASVVAAGLAVGLAAIGPGIGQGTASGGAVEGIARQPEAEGKIRGTLLLSLAFM ESLTIYGLVVALVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gnmt Peptide - N-terminal region (AAP43564)
AAP43564-100UG 100 µg

Gnmt Peptide - N-terminal region (AAP43564)

Sign In for Pricing
View Details
RGD1564937-set siRNA/shRNA/RNAi Lentivector (Rat)
39382096 4x 500 ng

RGD1564937-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Cd63 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6893106 1.0 µg DNA

Cd63 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Disperse Blue 359 (Technical Grade)
TRC-D494833-50MG 50 mg

Disperse Blue 359 (Technical Grade)

Sign In for Pricing
View Details
Human NUS1 (Dehydrodolichyl diphosphate synthase complex subunit NUS1) ELISA Kit
EH10726 96 Tests

Human NUS1 (Dehydrodolichyl diphosphate synthase complex subunit NUS1) ELISA Kit

Sign In for Pricing
View Details
Calindol Amide-13C
TRC-C148652-25MG 25 mg

Calindol Amide-13C

Sign In for Pricing
View Details