Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cortexin-2 (Ctxn2)

This Recombinant Mouse Cortexin-2 (Ctxn2) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Cortexin-2

UniProt

Q3URE8

Expression Region

1-81

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTYCGNSSAKMSVHEVSESSLSLEQKTGFAFVGILCIFLGLLIIRCFKILLDPYSSMP SSTWEDEVEEFDKGTFEYALA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IQGAP1 Antibody Picoband® Fluoro594 Conjugated
A01603-1-Fluoro594 100 µg/Vial

Anti-IQGAP1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
OSMR Protein Vector (Mouse) (pPB-C-His)
PV212746 500 ng

OSMR Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Hsa-miR-7974 miRNA Mimic
CMH2570-01 5 nmol

Hsa-miR-7974 miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-7974 miRNA Mimic
CMH2570-02 10 nmol

Hsa-miR-7974 miRNA Mimic

Sign In for Pricing
View Details
Transforming Growth Factor Beta - 1 (TGF-B1)
MBS343178-01 0.01 mg

Transforming Growth Factor Beta - 1 (TGF-B1)

Sign In for Pricing
View Details
Transforming Growth Factor Beta - 1 (TGF-B1)
MBS343178-02 0.1 mg

Transforming Growth Factor Beta - 1 (TGF-B1)

Sign In for Pricing
View Details