Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis ATP synthase subunit c (atpE)

This Recombinant Anabaena variabilis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3M9V6

Expression Region

1-81

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLVSAASVLAAALAVGLAAIGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOG-1 (DG1/447 + DOG1.1), 0.2mg/mL
BNUB0726-100 1x 100 µL

DOG-1 (DG1/447 + DOG1.1), 0.2mg/mL

Sign In for Pricing
View Details
KLF15 (NM_014079) Human Over-expression Lysate
LC402276 20 µg

KLF15 (NM_014079) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human HBAZ Protein (His Tag)
PKSH032531-01 10 µg

Recombinant Human HBAZ Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HBAZ Protein (His Tag)
PKSH032531-02 50 µg

Recombinant Human HBAZ Protein (His Tag)

Sign In for Pricing
View Details
Phalloidin-iFluor® 555 Conjugate
23119-AAT 300 Tests

Phalloidin-iFluor® 555 Conjugate

Sign In for Pricing
View Details
MCHR (MCHR1) Human Gene Knockout Kit (CRISPR)
KN400997 1 Kit

MCHR (MCHR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details