Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis ATP synthase subunit c (atpE)

This Recombinant Anabaena variabilis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3M9V6

Expression Region

1-81

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPLVSAASVLAAALAVGLAAIGPGIGQGNAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse CD117 Antibody
RD21056F-01 25 µg

FITC Anti-Mouse CD117 Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse CD117 Antibody
RD21056F-02 100 µg

FITC Anti-Mouse CD117 Antibody

Sign In for Pricing
View Details
Human TFAP2E activation kit by CRISPRa
GA117430 1 Kit

Human TFAP2E activation kit by CRISPRa

Sign In for Pricing
View Details
SIGLEC5 / SIGLEC14 Mouse Monoclonal Antibody [Clone ID: 1A5]
AM60041FC-N 100 µg

SIGLEC5 / SIGLEC14 Mouse Monoclonal Antibody [Clone ID: 1A5]

Sign In for Pricing
View Details
Cpb2 Mouse Gene Knockout Kit (CRISPR)
KN503746 1 Kit

Cpb2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human DNAJB11 activation kit by CRISPRa
GA109961 1 Kit

Human DNAJB11 activation kit by CRISPRa

Sign In for Pricing
View Details