Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acorus calamus ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Acorus calamus ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3V547

Expression Region

1-81

Origin

Acorus calamus (Sweet flag)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

General Purpose Oven BOGP-201
BOGP-201 1 Unit

General Purpose Oven BOGP-201

Sign In for Pricing
View Details
Recombinant MT-ND1 Antibody
RC-15056-01 50 μL

Recombinant MT-ND1 Antibody

Sign In for Pricing
View Details
Recombinant MT-ND1 Antibody
RC-15056-02 100 µL

Recombinant MT-ND1 Antibody

Sign In for Pricing
View Details
Recombinant MT-ND1 Antibody
RC-15056-03 1 mL

Recombinant MT-ND1 Antibody

Sign In for Pricing
View Details
ZNF480 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G2]
TA812654AM 100 µL

ZNF480 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G2]

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3293), CF647 conjugate, 0.1mg/mL
BNC473293-500 1x 500 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3293), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details