Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acorus calamus ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Acorus calamus ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q3V547

Expression Region

1-81

Origin

Acorus calamus (Sweet flag)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acid Phosphatase (ACP1) (NM_004300) Human Recombinant Protein
TP720178M 50 µg

Acid Phosphatase (ACP1) (NM_004300) Human Recombinant Protein

Sign In for Pricing
View Details
HCC1 (RBM39) Human Gene Knockout Kit (CRISPR)
KN421576 1 Kit

HCC1 (RBM39) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Phenylbutan-1-amine
TRC-P321000-50MG 50 mg

1-Phenylbutan-1-amine

Sign In for Pricing
View Details
NIFK Rabbit Polyclonal Antibody
TA365775 100 µL

NIFK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-(6-Aminohexyl)-5-chloro-1-naphthalenesulfonamide Hydrochloride
TRC-A610000-25MG 25 mg

N-(6-Aminohexyl)-5-chloro-1-naphthalenesulfonamide Hydrochloride

Sign In for Pricing
View Details
Mtap Mouse Gene Knockout Kit (CRISPR)
KN310456RB 1 Kit

Mtap Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details