Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acorus americanus ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Acorus americanus ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q4FGF2

Expression Region

1-81

Origin

Acorus americanus (Sweetflag)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal GGT1 (aa180-193) Antibody (internal region)
AMM04765G 0.1 mg

Polyclonal GGT1 (aa180-193) Antibody (internal region)

Sign In for Pricing
View Details
ATP6V1D (ATP6M, VATD) discontinued
507105 100 µg

ATP6V1D (ATP6M, VATD) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal DCK Antibody (OTI3F5) [DyLight 650]
NBP2-70555C 0.1 mL

Mouse Monoclonal DCK Antibody (OTI3F5) [DyLight 650]

Sign In for Pricing
View Details
Mouse XL Cytokine Premixed Kit Luminex Performance Assay
FCSTM20-37 1 Kit

Mouse XL Cytokine Premixed Kit Luminex Performance Assay

Sign In for Pricing
View Details
Dctn6 (NM_001106085) Rat Tagged ORF Clone
RR213155 10 µg

Dctn6 (NM_001106085) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Phospho-ZAP-70 (Y493) antibody
STJ90437 200 µl

Anti-Phospho-ZAP-70 (Y493) antibody

Sign In for Pricing
View Details