Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acorus americanus ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Acorus americanus ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q4FGF2

Expression Region

1-81

Origin

Acorus americanus (Sweetflag)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS37B Human Over-expression Lysate
orb1350882 100 µg

VPS37B Human Over-expression Lysate

Sign In for Pricing
View Details
Canine Hypoxia Inducible Factor 1 Subunit Alpha (HIF1A) ELISA Kit-Sandwich
EK8F62-01 48 Test

Canine Hypoxia Inducible Factor 1 Subunit Alpha (HIF1A) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Canine Hypoxia Inducible Factor 1 Subunit Alpha (HIF1A) ELISA Kit-Sandwich
EK8F62-02 96 Tests

Canine Hypoxia Inducible Factor 1 Subunit Alpha (HIF1A) ELISA Kit-Sandwich

Sign In for Pricing
View Details
HnRNP L/HNRNPL Rabbit Polyclonal Antibody (Fluoro594)
orb3107110 100 µg

HnRNP L/HNRNPL Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Lentiviral human ARMC6 sgRNA gene knockout kit - Lentiviral human ARMC6 sgRNA gene knockout kit (100)
GTR15390595 1 Vial

Lentiviral human ARMC6 sgRNA gene knockout kit - Lentiviral human ARMC6 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Recombinant Dechloromonas aromatica Ribonuclease 3 (rnc)
MBS1414212-01 0.02 mg (E-Coli)

Recombinant Dechloromonas aromatica Ribonuclease 3 (rnc)

Sign In for Pricing
View Details