Recombinant Human Cortexin-3 (CTXN3)
This Recombinant Human Cortexin-3 (CTXN3) spans the amino acid sequence from region 1-81.
Product Specifications
Product Name Alternative
Cortexin-3, Kidney and brain-expressed protein
UniProt
Q4LDR2
Expression Region
1-81
Origin
Homo sapiens (Human)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDGGQPIPSSLVPLGNESADSSMSLEQKMTFVFVILLFIFLGILIVRCFRILLDPYRSMP TSTWADGLEGLEKGQFDHALA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
031965-Biotin 200 µL
APG5, cleaved (T193) (APG5 Autophagy 5-like, APG5-like, APG5L, Apoptosis-specific Protein, ASP, ATG5 Autophagy-related 5 Homolog, Autophagy Protein 5, hAPG5, Homolog of S Cerevisiae Autophagy 5) (Biotin) discontinued
Sign In for Pricing
View Details MBS6234487-01 0.1 mL
Phosphodiesterase 5A (PDE5A, cGMP-Specific 3',5'-Cyclic Phosphodiesterase, cGMP-Binding cGMP-Specific Phosphodiesterase, CGB-PDE, PDE5) (MaxLight 750)
Sign In for Pricing
View Details MBS6234487-02 5x 0.1 mL
Phosphodiesterase 5A (PDE5A, cGMP-Specific 3',5'-Cyclic Phosphodiesterase, cGMP-Binding cGMP-Specific Phosphodiesterase, CGB-PDE, PDE5) (MaxLight 750)
Sign In for Pricing
View Details