Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cortexin-3 (CTXN3)

This Recombinant Human Cortexin-3 (CTXN3) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

Cortexin-3, Kidney and brain-expressed protein

UniProt

Q4LDR2

Expression Region

1-81

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGGQPIPSSLVPLGNESADSSMSLEQKMTFVFVILLFIFLGILIVRCFRILLDPYRSMP TSTWADGLEGLEKGQFDHALA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALK2 Protein, Human, Recombinant (His)
TMPJ-01072-01 5 µg

GALK2 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
GALK2 Protein, Human, Recombinant (His)
TMPJ-01072-02 10 µg

GALK2 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
GALK2 Protein, Human, Recombinant (His)
TMPJ-01072-03 20 µg

GALK2 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
GALK2 Protein, Human, Recombinant (His)
TMPJ-01072-04 50 µg

GALK2 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
GALK2 Protein, Human, Recombinant (His)
TMPJ-01072-05 100 µg

GALK2 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details
GALK2 Protein, Human, Recombinant (His)
TMPJ-01072-06 200 µg

GALK2 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details