Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat V-type proton ATPase subunit e 2 (Atp6v0e2)

This Recombinant Rat V-type proton ATPase subunit e 2 (Atp6v0e2) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

V-type proton ATPase subunit e 2, V-ATPase subunit e 2, Vacuolar proton pump subunit e 2

UniProt

Q5EB76

Expression Region

1-81

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL NPLFGPQLKNETIWYVRFLWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-myo-Inositol-1,3,4-trisphosphate Ammonium Salt-d6
TRC-D019388-10MG 10 mg

D-myo-Inositol-1,3,4-trisphosphate Ammonium Salt-d6

Sign In for Pricing
View Details
CMV-p65 (CMV101), CF568 conjugate, 0.1mg/mL
BNC680101-500 1x 500 µL

CMV-p65 (CMV101), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
JAK2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H9]
TA806795AM 100 µL

JAK2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H9]

Sign In for Pricing
View Details
Cyclic 17-(1,2-Ethanediyl Acetal) Androst-4-ene-3,17-dione
TRC-C990020-25MG 25 mg

Cyclic 17-(1,2-Ethanediyl Acetal) Androst-4-ene-3,17-dione

Sign In for Pricing
View Details
N-Succinimidyl 4-Azidosalicylate
TRC-S690130-50MG 50 mg

N-Succinimidyl 4-Azidosalicylate

Sign In for Pricing
View Details
Oct-2 (POU2F2) Goat Polyclonal Antibody
AP32061PU-N 100 µg

Oct-2 (POU2F2) Goat Polyclonal Antibody

Sign In for Pricing
View Details