Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat V-type proton ATPase subunit e 2 (Atp6v0e2)

This Recombinant Rat V-type proton ATPase subunit e 2 (Atp6v0e2) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

V-type proton ATPase subunit e 2, V-ATPase subunit e 2, Vacuolar proton pump subunit e 2

UniProt

Q5EB76

Expression Region

1-81

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL NPLFGPQLKNETIWYVRFLWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Nitro-2-(thiophen-2-ylsulfanyl)aniline Hydrochloride
TRC-N659840-250MG 250 mg

5-Nitro-2-(thiophen-2-ylsulfanyl)aniline Hydrochloride

Sign In for Pricing
View Details
Recombinant Human IL-36 Beta/IL-1F8 (153AA)
PKSH033871-01 10 µg

Recombinant Human IL-36 Beta/IL-1F8 (153AA)

Sign In for Pricing
View Details
Recombinant Human IL-36 Beta/IL-1F8 (153AA)
PKSH033871-02 50 µg

Recombinant Human IL-36 Beta/IL-1F8 (153AA)

Sign In for Pricing
View Details
IL19 Polyclonal Antibody
E-AB-16513-01 20 µL

IL19 Polyclonal Antibody

Sign In for Pricing
View Details
IL19 Polyclonal Antibody
E-AB-16513-02 60 µL

IL19 Polyclonal Antibody

Sign In for Pricing
View Details
IL19 Polyclonal Antibody
E-AB-16513-03 120 µL

IL19 Polyclonal Antibody

Sign In for Pricing
View Details