Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat V-type proton ATPase subunit e 2 (Atp6v0e2)

This Recombinant Rat V-type proton ATPase subunit e 2 (Atp6v0e2) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

V-type proton ATPase subunit e 2, V-ATPase subunit e 2, Vacuolar proton pump subunit e 2

UniProt

Q5EB76

Expression Region

1-81

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL NPLFGPQLKNETIWYVRFLWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Allomyrina dichotoma Lectin (Japanese Beetle) -Allo A-,  20nm
GP-6401-20 1 mL

Colloidal Gold Conjugated Allomyrina dichotoma Lectin (Japanese Beetle) -Allo A-, 20nm

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB646428 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (rTP53/1739), 1mg/mL
BNUM2091-50 1x 50 µL

P53 Tumor Suppressor Protein (rTP53/1739), 1mg/mL

Sign In for Pricing
View Details
Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), Biotin conjugate, 0.1mg/mL
BNCB2981-500 1x 500 µL

Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TLN (Talin) ELISA Kit
E-EL-H6072-01 24 Tests

Human TLN (Talin) ELISA Kit

Sign In for Pricing
View Details
Human TLN (Talin) ELISA Kit
E-EL-H6072-02 48 Tests

Human TLN (Talin) ELISA Kit

Sign In for Pricing
View Details