Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactuca sativa ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Lactuca sativa ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q56P08

Expression Region

1-81

Origin

Lactuca sativa (Garden lettuce)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RABL3 sgRNA gene knockout kit - Lentiviral human RABL3 sgRNA gene knockout kit (100)
GTR15389050 1 Vial

Lentiviral human RABL3 sgRNA gene knockout kit - Lentiviral human RABL3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Mouse Rtl8a qPCR Primer Pair
QM31250S 200 Tests

Mouse Rtl8a qPCR Primer Pair

Sign In for Pricing
View Details
UHRF1BP1 Rabbit Polyclonal Antibody (BF405)
orb2497587 100 µL

UHRF1BP1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
MIEN1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
28592061 1.0 µg DNA

MIEN1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SMG1 Recombinant Protein Antigen
NBP2-37870PEP 0.1 mL

SMG1 Recombinant Protein Antigen

Sign In for Pricing
View Details
ARL2, ID (ARL2, ADP-ribosylation factor-like protein 2) (FITC) discontinued
032070-FITC 200 µL

ARL2, ID (ARL2, ADP-ribosylation factor-like protein 2) (FITC) discontinued

Sign In for Pricing
View Details