Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza nivara ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Oryza nivara ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q6ENH9

Expression Region

1-81

Origin

Oryza nivara (Indian wild rice)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kelch-Like protein 23 (KLHL23) Mouse ELISA Kit
E4877 96 Tests

Kelch-Like protein 23 (KLHL23) Mouse ELISA Kit

Sign In for Pricing
View Details
Human MGAT4C knockdown cell line
ABC-KD9254 1 Vial

Human MGAT4C knockdown cell line

Sign In for Pricing
View Details
Rabbit Polyclonal EWSR1 Antibody [Janelia Fluor 549]
NB200-183JF549 0.1 mL

Rabbit Polyclonal EWSR1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Mouse Monoclonal GPR111 Antibody (594522) [HRP]
FAB64941H 0.1 mL

Mouse Monoclonal GPR111 Antibody (594522) [HRP]

Sign In for Pricing
View Details
Recombinant Uncharacterized protein Mb2606c (Mb2606c)
MBS7040993-01 0.02 mg

Recombinant Uncharacterized protein Mb2606c (Mb2606c)

Sign In for Pricing
View Details
Recombinant Uncharacterized protein Mb2606c (Mb2606c)
MBS7040993-02 0.1 mg

Recombinant Uncharacterized protein Mb2606c (Mb2606c)

Sign In for Pricing
View Details