Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza nivara ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Oryza nivara ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q6ENH9

Expression Region

1-81

Origin

Oryza nivara (Indian wild rice)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH2B adapter protein 1 (SH2B1) Human ELISA Kit
H0204 96 Tests

SH2B adapter protein 1 (SH2B1) Human ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CD45 Antibody (rPTPRC/7275) [Alexa Fluor 350]
NBP3-21141AF350 0.1 mL

Mouse Monoclonal CD45 Antibody (rPTPRC/7275) [Alexa Fluor 350]

Sign In for Pricing
View Details
AChRα2 siRNA (m)
sc-42527 10 µM

AChRα2 siRNA (m)

Sign In for Pricing
View Details
MAPK13/SAPK4 Polyclonal Antibody, Cy3 Conjugated
bs-7920R-Cy3-01 20 µL

MAPK13/SAPK4 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
MAPK13/SAPK4 Polyclonal Antibody, Cy3 Conjugated
bs-7920R-Cy3-02 100 µL

MAPK13/SAPK4 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
JNJ-49095397
BA6522-10 10 mg

JNJ-49095397

Sign In for Pricing
View Details