Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFA2, Human (HEK293, His)

The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, His) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BPIFA2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bpifa2-protein-human-hek293-his.html

Purity

90.00

Smiles

ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Molecular Formula

140683 (Gene_ID) Q96DR5 (E19-I249) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plant Osteocalcin/Bone Gla Protein (OT/BGP) ELISA Kit
MBS9375723 Inquire

Plant Osteocalcin/Bone Gla Protein (OT/BGP) ELISA Kit

Sign In for Pricing
View Details
Human SLC10A1 knockdown cell line
ABC-KD13850 1 Vial

Human SLC10A1 knockdown cell line

Sign In for Pricing
View Details
RBP3 (NM_002900) Human Recombinant Protein
TP701062 50 µg

RBP3 (NM_002900) Human Recombinant Protein

Sign In for Pricing
View Details
GPD1L (KIAA0089, Glycerol-3-phosphate Dehydrogenase 1-like Protein, GPD1-L) (Not for Export EU)
127483 100 µL

GPD1L (KIAA0089, Glycerol-3-phosphate Dehydrogenase 1-like Protein, GPD1-L) (Not for Export EU)

Sign In for Pricing
View Details
Adenosine Monophosphate (mixture of 2'(3')-phosphate isomers)-13C5 Sodium Salt
TRC-A281777-5MG 5 mg

Adenosine Monophosphate (mixture of 2'(3')-phosphate isomers)-13C5 Sodium Salt

Sign In for Pricing
View Details
SACM1L Antibody, FITC conjugated
A67764-100UG 100 µg

SACM1L Antibody, FITC conjugated

Sign In for Pricing
View Details