Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFA2, Human (HEK293, His)

The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, His) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BPIFA2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bpifa2-protein-human-hek293-his.html

Purity

90.00

Smiles

ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Molecular Formula

140683 (Gene_ID) Q96DR5 (E19-I249) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Candida albicans/C.glabrata/C.krusei Real-TM Multiplex Real Time PCR test
F3-100FRT 100 Tests

Candida albicans/C.glabrata/C.krusei Real-TM Multiplex Real Time PCR test

Sign In for Pricing
View Details
Recombinant Human CCL1/I-309
272-I-010 10 µg

Recombinant Human CCL1/I-309

Sign In for Pricing
View Details
pCMV-SPORT6-NCR1 Plasmid
PVT22318 2 µg

pCMV-SPORT6-NCR1 Plasmid

Sign In for Pricing
View Details
Lentiviral mouse Pex11g shRNA (UAS) - Lentiviral mouse Pex11g shRNA (UAS, iRFP) plasmid
GTR15173764 1 Vial

Lentiviral mouse Pex11g shRNA (UAS) - Lentiviral mouse Pex11g shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
KHK (Ketohexokinase (fructokinase) ) (AP) discontinued
247848-AP 100 µL

KHK (Ketohexokinase (fructokinase) ) (AP) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal ROBO4 Antibody [Alexa Fluor 647]
NB110-58780AF647 0.1 mL

Rabbit Polyclonal ROBO4 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details