Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFA2, Human (HEK293, His)

The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, His) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BPIFA2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bpifa2-protein-human-hek293-his.html

Purity

90.00

Smiles

ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Molecular Formula

140683 (Gene_ID) Q96DR5 (E19-I249) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2R)-2-(Acetylamino)butanoic Acid-d5
TRC-A168236-5MG 5 mg

(2R)-2-(Acetylamino)butanoic Acid-d5

Sign In for Pricing
View Details
MPZL3 rabbit pAb
ES19743-01 50 µL

MPZL3 rabbit pAb

Sign In for Pricing
View Details
MPZL3 rabbit pAb
ES19743-02 100 µL

MPZL3 rabbit pAb

Sign In for Pricing
View Details
(6,7,8,9-tetrahydrodibenzo[b, d]furan-2-yloxy) acetic acid
sc-357223 250 mg

(6,7,8,9-tetrahydrodibenzo[b, d]furan-2-yloxy) acetic acid

Sign In for Pricing
View Details
Cfap97d1 (NM_001134601) Rat Tagged ORF Clone
RR211370 10 µg

Cfap97d1 (NM_001134601) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Rhizobium sp. Pantothenate synthetase (panC)
MBS1001710-01 0.02 mg (E-Coli)

Recombinant Rhizobium sp. Pantothenate synthetase (panC)

Sign In for Pricing
View Details