Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFA2, Human (HEK293, His)

The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, His) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BPIFA2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bpifa2-protein-human-hek293-his.html

Purity

90.00

Smiles

ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Molecular Formula

140683 (Gene_ID) Q96DR5 (E19-I249) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Androgen receptor Recombinant Antibody, APC Conjugated
bsm-61204R-APC-01 20 µL

Androgen receptor Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Androgen receptor Recombinant Antibody, APC Conjugated
bsm-61204R-APC-02 100 µL

Androgen receptor Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Lentiviral human SAMD13 shRNA (UAS) - Lentiviral human SAMD13 shRNA (UAS, RFP) (25)
GTR15338510 1 Vial

Lentiviral human SAMD13 shRNA (UAS) - Lentiviral human SAMD13 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
CXCL12, CT (CXCL12, SDF1, SDF1A, SDF1B, Stromal cell-derived factor 1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, Pre-B cell growth-stimulating factor, SDF-1-beta (3-72), SDF-1-alpha (3-67) ) (PE) discontinued
034381-PE 200 µL

CXCL12, CT (CXCL12, SDF1, SDF1A, SDF1B, Stromal cell-derived factor 1, C-X-C motif chemokine 12, Intercrine reduced in hepatomas, Pre-B cell growth-stimulating factor, SDF-1-beta (3-72), SDF-1-alpha (3-67) ) (PE) discontinued

Sign In for Pricing
View Details
NTS Protein (N-His, Human)
P506700 100 µg

NTS Protein (N-His, Human)

Sign In for Pricing
View Details
Magoh 3'UTR GFP Stable Cell Line
TU262781 1.0 mL

Magoh 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details