Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFA2, Human (HEK293, His)

The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, His) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BPIFA2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bpifa2-protein-human-hek293-his.html

Purity

90.00

Smiles

ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Molecular Formula

140683 (Gene_ID) Q96DR5 (E19-I249) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN18 Over-expression Lysate Product
GWB-E2EE02 0.1 mg

TSPAN18 Over-expression Lysate Product

Sign In for Pricing
View Details
Human SCCPDH qPCR Primer Pair
QH40437S 200 Tests

Human SCCPDH qPCR Primer Pair

Sign In for Pricing
View Details
Tryptophan Hydroxylase Blocking Peptide
MBS9617815-01 1 mg

Tryptophan Hydroxylase Blocking Peptide

Sign In for Pricing
View Details
Tryptophan Hydroxylase Blocking Peptide
MBS9617815-02 5x 1 mg

Tryptophan Hydroxylase Blocking Peptide

Sign In for Pricing
View Details
Scnn1b (NM_012648) Rat Tagged Lenti ORF Clone
RR203161L4 10 µg

Scnn1b (NM_012648) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Phospho-BCL2 (Ser87) Antibody
MBS7133048-01 0.1 mL

Phospho-BCL2 (Ser87) Antibody

Sign In for Pricing
View Details