Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFA2, Human (HEK293, His)

The BPIFA2 protein, also known as bactericidal/permeability-increasing fold family A member 2, has significant antibacterial activity, particularly against Pseudomonas aeruginosa. The protein is effective against bacterial infections caused by Pseudomonas aeruginosa, a pathogen known to be resistant to many antibiotics. BPIFA2 Protein, Human (HEK293, His) is the recombinant human-derived BPIFA2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BPIFA2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bpifa2-protein-human-hek293-his.html

Purity

90.00

Smiles

ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI

Molecular Formula

140683 (Gene_ID) Q96DR5 (E19-I249) (Accession)

Molecular Weight

Approximately 35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pdk4 shRNA (UAS) - Lentiviral mouse Pdk4 shRNA (UAS, GFP) plasmid
GTR15245614 1 Vial

Lentiviral mouse Pdk4 shRNA (UAS) - Lentiviral mouse Pdk4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
APOL6, ID (APOL6, Apolipoprotein L6, Apolipoprotein L-VI) (APC) discontinued
031991-APC 200 µL

APOL6, ID (APOL6, Apolipoprotein L6, Apolipoprotein L-VI) (APC) discontinued

Sign In for Pricing
View Details
TRNAH3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2491708 1.0 µg DNA

TRNAH3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Melphalan Ethyl Ester Hydrochloride
454322-01 10 mg

Melphalan Ethyl Ester Hydrochloride

Sign In for Pricing
View Details
Melphalan Ethyl Ester Hydrochloride
454322-02 25 mg

Melphalan Ethyl Ester Hydrochloride

Sign In for Pricing
View Details
PDE7B Antibody
MBS859529-01 0.1 mg

PDE7B Antibody

Sign In for Pricing
View Details